Lineage for d2ooda1 (2ood A:3-72,A:398-467)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810354Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1810355Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1810476Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)
  6. 1810477Protein Guanine deaminase [159336] (3 species)
  7. 1810478Species Bradyrhizobium japonicum [TaxId:375] [159337] (1 PDB entry)
    Uniprot Q89NG0 1-70,396-465
    Blr3880
  8. 1810479Domain d2ooda1: 2ood A:3-72,A:398-467 [148921]
    Other proteins in same PDB: d2ooda2
    complexed with gun, zn

Details for d2ooda1

PDB Entry: 2ood (more details), 2.62 Å

PDB Description: crystal structure of guanine deaminase from bradyrhizobium japonicum
PDB Compounds: (A:) Blr3880 protein

SCOPe Domain Sequences for d2ooda1:

Sequence, based on SEQRES records: (download)

>d2ooda1 b.92.1.4 (A:3-72,A:398-467) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]}
lttvgirgtffdfvddpwkhigneqaaarfhqdglmvvtdgvikafgpyekiaaahpgve
ithikdriivXfepgkeadfvaldpnggqlaqpwhqsliadgagprtvdeaasmlfavmm
vgddrcvdetwvmgkrlykks

Sequence, based on observed residues (ATOM records): (download)

>d2ooda1 b.92.1.4 (A:3-72,A:398-467) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]}
lttvgirgtffdfvddpwkhigneqaaarfhqdglmvvtdgvikafgpyekiaaahpgve
ithikdriivXfepgkeadfvaldpnggqlaqpwhqsligagprtvdeaasmlfavmmvg
ddrcvdetwvmgkrlykks

SCOPe Domain Coordinates for d2ooda1:

Click to download the PDB-style file with coordinates for d2ooda1.
(The format of our PDB-style files is described here.)

Timeline for d2ooda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ooda2