Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) contains additional, fifth helix at the N-terminus |
Family a.24.10.6: SphA-like [158394] (1 protein) |
Protein Histidine phosphotransferase ShpA [158395] (1 species) |
Species Caulobacter crescentus [TaxId:155892] [158396] (1 PDB entry) Uniprot A0EJF9 8-111 |
Domain d2oocb_: 2ooc B: [148920] automated match to d2ooca1 complexed with gol, pg4 |
PDB Entry: 2ooc (more details), 1.52 Å
SCOPe Domain Sequences for d2oocb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oocb_ a.24.10.6 (B:) Histidine phosphotransferase ShpA {Caulobacter crescentus [TaxId: 155892]} gavdfaylegfaagdfavvdevlalfreqaalwapmldpthpgwkdavhtvkgaargvga fnlgevcerceagqeslegvrtaldaalldiaayaheqalrslkg
Timeline for d2oocb_: