SCOPe 2.08: Domain d2oocb_: 2ooc B:

Lineage for d2oocb_ (2ooc B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.6: SphA-like [158394] (1 protein)

6. Protein Histidine phosphotransferase ShpA [158395] (1 species)

7. Species Caulobacter crescentus [TaxId:155892] [158396] (1 PDB entry)
   Uniprot A0EJF9 8-111

8. Domain d2oocb_: 2ooc B: [148920]
   automated match to d2ooca1
   complexed with gol, pg4

Details for d2oocb_

PDB Entry: 2ooc, 1.52 Å

PDB Description: crystal structure of histidine phosphotransferase shpa (np_419930.1) from caulobacter crescentus at 1.52 a resolution

PDB Compounds: (B:) Histidine phosphotransferase

SCOPe Domain Sequences for d2oocb_:

Sequence; same for both SEQRES and ATOM records:

>d2oocb_ a.24.10.6 (B:) Histidine phosphotransferase ShpA {Caulobacter crescentus [TaxId: 155892]}
gavdfaylegfaagdfavvdevlalfreqaalwapmldpthpgwkdavhtvkgaargvga
fnlgevcerceagqeslegvrtaldaalldiaayaheqalrslkg

Timeline for d2oocb_:

• d2oocb_ first appeared in SCOP 1.75, called d2oocb1
  
• d2oocb_ appears in SCOPe 2.07