SCOPe 2.08: Domain d2ooca1: 2ooc A:8-111

Lineage for d2ooca1 (2ooc A:8-111)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.6: SphA-like [158394] (1 protein)

6. Protein Histidine phosphotransferase ShpA [158395] (1 species)

7. Species Caulobacter crescentus [TaxId:155892] [158396] (1 PDB entry)
   Uniprot A0EJF9 8-111

8. Domain d2ooca1: 2ooc A:8-111 [148919]
   complexed with gol, pg4

Details for d2ooca1

PDB Entry: 2ooc, 1.52 Å

PDB Description: crystal structure of histidine phosphotransferase shpa (np_419930.1) from caulobacter crescentus at 1.52 a resolution

PDB Compounds: (A:) Histidine phosphotransferase

SCOPe Domain Sequences for d2ooca1:

Sequence; same for both SEQRES and ATOM records:

>d2ooca1 a.24.10.6 (A:8-111) Histidine phosphotransferase ShpA {Caulobacter crescentus [TaxId: 155892]}
gavdfaylegfaagdfavvdevlalfreqaalwapmldpthpgwkdavhtvkgaargvga
fnlgevcerceagqeslegvrtaldaalldiaayaheqalrslk

Timeline for d2ooca1:

• d2ooca1 first appeared in SCOP 1.75
  
• d2ooca1 appears in SCOPe 2.07