Lineage for d2oo3a1 (2oo3 A:9-279)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130528Family c.66.1.59: LPG1296-like [159700] (1 protein)
    Pfam PF04378; DUF519
  6. 2130529Protein Uncharacterized protein LPG1296 [159701] (1 species)
    involved in catabolism of external DNA
  7. 2130530Species Legionella pneumophila [TaxId:446] [159702] (1 PDB entry)
    Uniprot Q5ZVZ2 14-284
  8. 2130531Domain d2oo3a1: 2oo3 A:9-279 [148918]
    complexed with so4

Details for d2oo3a1

PDB Entry: 2oo3 (more details), 2 Å

PDB Description: Crystal structure of protein LPL1258 from Legionella pneumophila str. Philadelphia 1, Pfam DUF519
PDB Compounds: (A:) Protein involved in catabolism of external DNA

SCOPe Domain Sequences for d2oo3a1:

Sequence, based on SEQRES records: (download)

>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]}
hagnfadvikhitltrllaylthkdkplfylethsgrgiydlkdkqslkteeykeginpv
wldrenlpslfleyisvikqinlnstlsyypgspyfainqlrsqdrlylcelhpteynfl
lklphfnkkvyvnhtdgvsklnallpppekrglifidpsyerkeeykeipyaiknayskf
stglycvwypvvnkawteqflrkmreissksvrielhlnplinegmtgcglwiinppytf
pseiklvletlttyfnpgsssymiesgsklc

Sequence, based on observed residues (ATOM records): (download)

>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]}
hagnfadvikhitltrllaylthkdkplfylethsgrgiydlkdkteeykeginpvwldr
enlpslfleyisvikqinlnstlsyypgspyfainqlrsqdrlylcelhpteynfllklp
hfnkkvyvnhtdgvsklnallpppekrglifidpsyerkeeykeipyaiknayskfstgl
ycvwypvvnkawteqflrkmreissksvrielhlnplinegmtgcglwiinppytfpsei
klvletlttyfnpgsssymiesgsklc

SCOPe Domain Coordinates for d2oo3a1:

Click to download the PDB-style file with coordinates for d2oo3a1.
(The format of our PDB-style files is described here.)

Timeline for d2oo3a1: