Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) |
Family c.66.1.15: Arylamine N-methyltransferase [69547] (2 proteins) |
Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69549] (12 PDB entries) |
Domain d2onya1: 2ony A:24-280 [148915] automatically matched to d1hnnb_ complexed with po4, sah, tmj |
PDB Entry: 2ony (more details), 2.6 Å
SCOP Domain Sequences for d2onya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onya1 c.66.1.15 (A:24-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq tgvddvkgvffawaqkv
Timeline for d2onya1: