Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins) automatically mapped to Pfam PF01234 |
Protein automated matches [190168] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186895] (34 PDB entries) |
Domain d2onya_: 2ony A: [148915] Other proteins in same PDB: d2onyb3 automated match to d1hnnb_ complexed with po4, sah, tmj |
PDB Entry: 2ony (more details), 2.6 Å
SCOPe Domain Sequences for d2onya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onya_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq tgvddvkgvffawaqkv
Timeline for d2onya_: