Lineage for d2onsa_ (2ons A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879695Protein Molybdate-binding protein, ModA [53883] (3 species)
  7. 1879696Species Archaeoglobus fulgidus [TaxId:2234] [159807] (3 PDB entries)
    Uniprot O30142 32-342
  8. 1879697Domain d2onsa_: 2ons A: [148914]
    automated match to d2onra_
    complexed with mg, no3, wo4

Details for d2onsa_

PDB Entry: 2ons (more details), 1.55 Å

PDB Description: Crystal structure of A. fulgidus periplasmic binding protein ModA with bound tungstate
PDB Compounds: (A:) UPF0100 protein AF_0094

SCOPe Domain Sequences for d2onsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onsa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]}
ghmnvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadvia
tadytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfs
npnddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsseriein
kskimirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskv
kvvlangkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppra
dtavpslkamvevs

SCOPe Domain Coordinates for d2onsa_:

Click to download the PDB-style file with coordinates for d2onsa_.
(The format of our PDB-style files is described here.)

Timeline for d2onsa_: