SCOPe 2.08: Domain d2onsa2: 2ons A:32-342

Lineage for d2onsa2 (2ons A:32-342)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Molybdate-binding protein, ModA [53883] (3 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159807] (3 PDB entries)
   Uniprot O30142 32-342

8. Domain d2onsa2: 2ons A:32-342 [148914]
   Other proteins in same PDB: d2onsa3
   automated match to d2onra_
   complexed with mg, no3, wo4

Details for d2onsa2

PDB Entry: 2ons, 1.55 Å

PDB Description: Crystal structure of A. fulgidus periplasmic binding protein ModA with bound tungstate

PDB Compounds: (A:) UPF0100 protein AF_0094

SCOPe Domain Sequences for d2onsa2:

Sequence; same for both SEQRES and ATOM records:

>d2onsa2 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]}
nvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadviatad
ytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfsnpn
ddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsserieinksk
imirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskvkvv
langkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppradta
vpslkamvevs

Timeline for d2onsa2:

• d2onsa2 first appeared in SCOP 1.75, called d2onsa1
  
• d2onsa2 appears in SCOPe 2.07