SCOPe 2.08: Domain d2onra2: 2onr A:32-342

Lineage for d2onra2 (2onr A:32-342)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Molybdate-binding protein, ModA [53883] (3 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159807] (3 PDB entries)
   Uniprot O30142 32-342

8. Domain d2onra2: 2onr A:32-342 [148913]
   Other proteins in same PDB: d2onra3
   automated match to d2onke1
   complexed with mg, moo, no3

Details for d2onra2

PDB Entry: 2onr, 1.6 Å

PDB Description: Crystal structure of A. fulgidus periplasmic binding protein ModA with bound molybdate

PDB Compounds: (A:) UPF0100 protein AF_0094

SCOPe Domain Sequences for d2onra2:

Sequence; same for both SEQRES and ATOM records:

>d2onra2 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]}
nvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadviatad
ytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfsnpn
ddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsserieinksk
imirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskvkvv
langkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppradta
vpslkamvevs

Timeline for d2onra2:

• d2onra2 first appeared in SCOP 1.75, called d2onra1
  
• d2onra2 appears in SCOPe 2.07