Lineage for d2onkj_ (2onk J:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879695Protein Molybdate-binding protein, ModA [53883] (3 species)
  7. 1879696Species Archaeoglobus fulgidus [TaxId:2234] [159807] (3 PDB entries)
    Uniprot O30142 32-342
  8. 1879700Domain d2onkj_: 2onk J: [148912]
    Other proteins in same PDB: d2onka1, d2onkb_, d2onkc1, d2onkd1, d2onkf_, d2onkg_, d2onkh1, d2onki1
    automated match to d2onsa_
    complexed with mg, po4, wo4

Details for d2onkj_

PDB Entry: 2onk (more details), 3.1 Å

PDB Description: ABC transporter ModBC in complex with its binding protein ModA
PDB Compounds: (J:) molybdate/tungstate binding protein

SCOPe Domain Sequences for d2onkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onkj_ c.94.1.1 (J:) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]}
ghmnvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadvia
tadytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfs
npnddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsseriein
kskimirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskv
kvvlangkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppra
dtavpslkam

SCOPe Domain Coordinates for d2onkj_:

Click to download the PDB-style file with coordinates for d2onkj_.
(The format of our PDB-style files is described here.)

Timeline for d2onkj_: