![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Molybdate-binding protein, ModA [53883] (3 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [159807] (3 PDB entries) Uniprot O30142 32-342 |
![]() | Domain d2onkj2: 2onk J:32-338 [148912] Other proteins in same PDB: d2onka1, d2onkb_, d2onkc1, d2onkd1, d2onkf_, d2onkg_, d2onkh1, d2onki1, d2onkj3 automated match to d2onsa_ complexed with mg, po4, wo4 |
PDB Entry: 2onk (more details), 3.1 Å
SCOPe Domain Sequences for d2onkj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onkj2 c.94.1.1 (J:32-338) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} nvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadviatad ytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfsnpn ddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsserieinksk imirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskvkvv langkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppradta vpslkam
Timeline for d2onkj2: