Lineage for d2onkg_ (2onk G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870403Protein automated matches [190723] (8 species)
    not a true protein
  7. 2870404Species Archaeoglobus fulgidus [TaxId:2234] [255529] (1 PDB entry)
  8. 2870407Domain d2onkg_: 2onk G: [148909]
    Other proteins in same PDB: d2onka1, d2onkc1, d2onkd1, d2onke1, d2onkh1, d2onki1, d2onkj2, d2onkj3
    automated match to d2onka1
    complexed with mg, po4, wo4

Details for d2onkg_

PDB Entry: 2onk (more details), 3.1 Å

PDB Description: ABC transporter ModBC in complex with its binding protein ModA
PDB Compounds: (G:) Molybdate/tungstate ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d2onkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onkg_ c.37.1.12 (G:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga
ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll
drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi
lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild

SCOPe Domain Coordinates for d2onkg_:

Click to download the PDB-style file with coordinates for d2onkg_.
(The format of our PDB-style files is described here.)

Timeline for d2onkg_: