Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein automated matches [190723] (8 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [255529] (1 PDB entry) |
Domain d2onkg_: 2onk G: [148909] Other proteins in same PDB: d2onka1, d2onkc1, d2onkd1, d2onke1, d2onkh1, d2onki1, d2onkj2, d2onkj3 automated match to d2onka1 complexed with mg, po4, wo4 |
PDB Entry: 2onk (more details), 3.1 Å
SCOPe Domain Sequences for d2onkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onkg_ c.37.1.12 (G:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild
Timeline for d2onkg_: