Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
Protein Hypothetical protein Ta0195 [160793] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [160794] (1 PDB entry) Uniprot Q9HLN2 1-139 |
Domain d2onfb2: 2onf B:1-139 [148902] Other proteins in same PDB: d2onfa2, d2onfb3 automated match to d2onfa1 complexed with coa, edo |
PDB Entry: 2onf (more details), 1.7 Å
SCOPe Domain Sequences for d2onfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onfb2 d.227.1.1 (B:1-139) Hypothetical protein Ta0195 {Thermoplasma acidophilum [TaxId: 2303]} mhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttfle fkdrmginlkswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaekyc fisrairnnveeivdyefv
Timeline for d2onfb2: