SCOPe 2.08: Domain d2onfb2: 2onf B:1-139

Lineage for d2onfb2 (2onf B:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)

6. Protein Hypothetical protein Ta0195 [160793] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [160794] (1 PDB entry)
   Uniprot Q9HLN2 1-139

8. Domain d2onfb2: 2onf B:1-139 [148902]
   Other proteins in same PDB: d2onfa2, d2onfb3
   automated match to d2onfa1
   complexed with coa, edo

Details for d2onfb2

PDB Entry: 2onf, 1.7 Å

PDB Description: crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution

PDB Compounds: (B:) Hypothetical protein Ta0195

SCOPe Domain Sequences for d2onfb2:

Sequence; same for both SEQRES and ATOM records:

>d2onfb2 d.227.1.1 (B:1-139) Hypothetical protein Ta0195 {Thermoplasma acidophilum [TaxId: 2303]}
mhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttfle
fkdrmginlkswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaekyc
fisrairnnveeivdyefv

Timeline for d2onfb2:

• d2onfb2 first appeared in SCOP 1.75, called d2onfb1
  
• d2onfb2 appears in SCOPe 2.07