Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (2 families) |
Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (7 proteins) |
Protein Hypothetical protein Ta0195 [160793] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [160794] (1 PDB entry) Uniprot Q9HLN2 1-139 |
Domain d2onfa1: 2onf A:1-139 [148901] complexed with coa, edo |
PDB Entry: 2onf (more details), 1.7 Å
SCOP Domain Sequences for d2onfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onfa1 d.227.1.1 (A:1-139) Hypothetical protein Ta0195 {Thermoplasma acidophilum [TaxId: 2303]} mhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttfle fkdrmginlkswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaekyc fisrairnnveeivdyefv
Timeline for d2onfa1: