SCOP 1.75: Domain d2onfa1: 2onf A:1-139

Lineage for d2onfa1 (2onf A:1-139)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (2 families)

5. Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (7 proteins)

6. Protein Hypothetical protein Ta0195 [160793] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [160794] (1 PDB entry)
   Uniprot Q9HLN2 1-139

8. Domain d2onfa1: 2onf A:1-139 [148901]
   complexed with coa, edo

Details for d2onfa1

PDB Entry: 2onf, 1.7 Å

PDB Description: crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution

PDB Compounds: (A:) Hypothetical protein Ta0195

SCOP Domain Sequences for d2onfa1:

Sequence; same for both SEQRES and ATOM records:

>d2onfa1 d.227.1.1 (A:1-139) Hypothetical protein Ta0195 {Thermoplasma acidophilum [TaxId: 2303]}
mhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttfle
fkdrmginlkswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaekyc
fisrairnnveeivdyefv

Timeline for d2onfa1:

• d2onfa1 is new in SCOP 1.75
  
• d2onfa1 appears in SCOPe 2.01
  
• d2onfa1 appears in the current release, SCOPe 2.08