Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (10 families) |
Family a.118.8.7: HAT/Suf repeat [158782] (4 proteins) includes Pfam PF05843 Pfam PF02184 this is a repeat family; one repeat unit is 2ond A:372-408 found in domain |
Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [158784] (2 PDB entries) Uniprot Q99LI7 21-549! Uniprot Q99LI7 242-549 |
Domain d2ondb_: 2ond B: [148900] automated match to d2onda1 |
PDB Entry: 2ond (more details), 2.8 Å
SCOPe Domain Sequences for d2ondb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ondb_ a.118.8.7 (B:) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} tpqeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyl eqsskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhs iynrllaiedidptlvyiqymkfarraegiksgrmifkkaredartrhhvyvtaalmeyy cskdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeks geiwarflafesnigdlasilkvekrrftafreeyegketallvdrykfmdlypcsasel kalgykdv
Timeline for d2ondb_: