Lineage for d2ondb_ (2ond B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339986Family a.118.8.7: HAT/Suf repeat [158782] (4 proteins)
    includes Pfam PF05843
    Pfam PF02184

    this is a repeat family; one repeat unit is 2ond A:372-408 found in domain
  6. 2339987Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (1 species)
  7. 2339988Species Mouse (Mus musculus) [TaxId:10090] [158784] (2 PDB entries)
    Uniprot Q99LI7 21-549! Uniprot Q99LI7 242-549
  8. 2339990Domain d2ondb_: 2ond B: [148900]
    automated match to d2onda1

Details for d2ondb_

PDB Entry: 2ond (more details), 2.8 Å

PDB Description: crystal structure of the hat-c domain of murine cstf-77
PDB Compounds: (B:) Cleavage stimulation factor 77 kDa subunit

SCOPe Domain Sequences for d2ondb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ondb_ a.118.8.7 (B:) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}
tpqeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyl
eqsskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhs
iynrllaiedidptlvyiqymkfarraegiksgrmifkkaredartrhhvyvtaalmeyy
cskdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeks
geiwarflafesnigdlasilkvekrrftafreeyegketallvdrykfmdlypcsasel
kalgykdv

SCOPe Domain Coordinates for d2ondb_:

Click to download the PDB-style file with coordinates for d2ondb_.
(The format of our PDB-style files is described here.)

Timeline for d2ondb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2onda1