Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (8 families) |
Family a.118.8.7: HAT/Suf repeat [158782] (1 protein) includes Pfam PF05843 this is a repeat family; one repeat unit is 2ond A:372-408 found in domain |
Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [158784] (2 PDB entries) Uniprot Q99LI7 21-549! Uniprot Q99LI7 242-549 |
Domain d2ondb1: 2ond B:242-549 [148900] automatically matched to 2OND A:242-549 |
PDB Entry: 2ond (more details), 2.8 Å
SCOP Domain Sequences for d2ondb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ondb1 a.118.8.7 (B:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} tpqeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyl eqsskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhs iynrllaiedidptlvyiqymkfarraegiksgrmifkkaredartrhhvyvtaalmeyy cskdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeks geiwarflafesnigdlasilkvekrrftafreeyegketallvdrykfmdlypcsasel kalgykdv
Timeline for d2ondb1: