SCOP 1.75: Domain d2oncd2: 2onc D:509-766

Lineage for d2oncd2 (2onc D:509-766)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (29 PDB entries)
   Uniprot P27487 39-776
   Uniprot P27487
   Uniprot P27487
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2oncd2: 2onc D:509-766 [148898]
   Other proteins in same PDB: d2onca1, d2oncb1, d2oncc1, d2oncd1
   automatically matched to d1orva2
   complexed with nag, sy1

Details for d2oncd2

PDB Entry: 2onc, 2.55 Å

PDB Description: crystal structure of human dpp-4

PDB Compounds: (D:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2oncd2:

Sequence; same for both SEQRES and ATOM records:

>d2oncd2 c.69.1.24 (D:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2oncd2:

• d2oncd2 is new in SCOP 1.75
  
• d2oncd2 appears in SCOPe 2.01
  
• d2oncd2 appears in the current release, SCOPe 2.08