Lineage for d2oncc1 (2onc C:40-508)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803668Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1803776Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 1803777Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 1803784Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 1803785Species Human (Homo sapiens) [TaxId:9606] [82174] (82 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 1803898Domain d2oncc1: 2onc C:40-508 [148895]
    Other proteins in same PDB: d2onca2, d2oncb2, d2oncc2, d2oncd2
    automated match to d4n8eb1
    complexed with nag, sy1

Details for d2oncc1

PDB Entry: 2onc (more details), 2.55 Å

PDB Description: crystal structure of human dpp-4
PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2oncc1:

Sequence, based on SEQRES records: (download)

>d2oncc1 b.70.3.1 (C:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
aktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Sequence, based on observed residues (ATOM records): (download)

>d2oncc1 b.70.3.1 (C:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
aktytltdylkntyrlklyslrwisdheylyknnilvfnaeygnssvflenstfdefghs
indysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvg
hklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngt
flayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtn
atsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclv
arqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkctfitkgtwe
vigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfsk
eakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2oncc1:

Click to download the PDB-style file with coordinates for d2oncc1.
(The format of our PDB-style files is described here.)

Timeline for d2oncc1: