![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries) |
![]() | Domain d2onca2: 2onc A:509-766 [148892] Other proteins in same PDB: d2onca1, d2onca3, d2oncb1, d2oncb3, d2oncc1, d2oncc3, d2oncd1, d2oncd3 automated match to d4n8db2 complexed with nag, sy1 |
PDB Entry: 2onc (more details), 2.55 Å
SCOPe Domain Sequences for d2onca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onca2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d2onca2: