Lineage for d2omzb_ (2omz B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768951Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1768952Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries)
  8. 1768953Domain d2omzb_: 2omz B: [148890]
    Other proteins in same PDB: d2omza1, d2omza2
    automated match to d1o6sb_

Details for d2omzb_

PDB Entry: 2omz (more details), 1.6 Å

PDB Description: crystal structure of inla y369a/hec1 complex
PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omzb_ b.1.6.1 (B:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
gplgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiiere
tgwlkvtepldreriatytlfshavssngnavedpmeilitvtdq

SCOPe Domain Coordinates for d2omzb_:

Click to download the PDB-style file with coordinates for d2omzb_.
(The format of our PDB-style files is described here.)

Timeline for d2omzb_: