Lineage for d2omxb2 (2omx B:2-104)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037201Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2037202Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)
  8. 2037205Domain d2omxb2: 2omx B:2-104 [148887]
    Other proteins in same PDB: d2omxa1, d2omxa3, d2omxb3
    automated match to d1o6sb_
    complexed with ca, cl

Details for d2omxb2

PDB Entry: 2omx (more details), 1.7 Å

PDB Description: crystal structure of inla s192n g194s+s/hec1 complex
PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omxb2 b.1.6.1 (B:2-104) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
wvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlk
vtepldreriatytlfshavssngnavedpmeilitvtdqndn

SCOPe Domain Coordinates for d2omxb2:

Click to download the PDB-style file with coordinates for d2omxb2.
(The format of our PDB-style files is described here.)

Timeline for d2omxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omxb3