SCOPe 2.05: Domain d2omxb_: 2omx B:

Lineage for d2omxb_ (2omx B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries)

8. Domain d2omxb_: 2omx B: [148887]
   Other proteins in same PDB: d2omxa1, d2omxa3
   automated match to d1o6sb_
   complexed with ca, cl

Details for d2omxb_

PDB Entry: 2omx, 1.7 Å

PDB Description: crystal structure of inla s192n g194s+s/hec1 complex

PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omxb_:

Sequence; same for both SEQRES and ATOM records:

>d2omxb_ b.1.6.1 (B:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
gwlkvtepldreriatytlfshavssngnavedpmeilitvtdqndn

Timeline for d2omxb_:

• d2omxb_ first appeared in SCOP 1.75, called d2omxb1
  
• d2omxb_ appears in SCOPe 2.04
  
• d2omxb_ is called d2omxb2 in SCOPe 2.06
  
• d2omxb_ appears in the current release, SCOPe 2.08, called d2omxb2