SCOP 1.75: Domain d2omua1: 2omu A:420-496

Lineage for d2omua1 (2omu A:420-496)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
   truncated fold fused to an LRR domain

6. Protein Internalin B [69172] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [69173] (5 PDB entries)

8. Domain d2omua1: 2omu A:420-496 [148882]
   Other proteins in same PDB: d2omua2, d2omub1
   automatically matched to d1h6ta1
   complexed with ca, cl; mutant

Details for d2omua1

PDB Entry: 2omu, 1.8 Å

PDB Description: crystal structure of inla g194s+s y369s/hec1 complex

PDB Compounds: (A:) Internalin-A

SCOP Domain Sequences for d2omua1:

Sequence; same for both SEQRES and ATOM records:

>d2omua1 b.1.18.15 (A:420-496) Internalin B {Listeria monocytogenes [TaxId: 1639]}
napvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqpvt
igkgtttfsgtvtqplk

Timeline for d2omua1:

• d2omua1 is new in SCOP 1.75
  
• d2omua1 appears in SCOPe 2.01
  
• d2omua1 appears in the current release, SCOPe 2.08