Lineage for d2omtb1 (2omt B:-2-101)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788328Superfamily b.1.6: Cadherin-like [49313] (2 families) (S)
  5. 788329Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 788337Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 788338Species Human (Homo sapiens) [TaxId:9606] [81981] (7 PDB entries)
  8. 788345Domain d2omtb1: 2omt B:-2-101 [148881]
    Other proteins in same PDB: d2omta1, d2omta2
    automatically matched to d1o6sb_
    complexed with ca, cl; mutant

Details for d2omtb1

PDB Entry: 2omt (more details), 2 Å

PDB Description: Crystal structure of InlA G194S+S/hEC1 complex
PDB Compounds: (B:) Epithelial-cadherin; E-Cad/CTF1

SCOP Domain Sequences for d2omtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omtb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
gwlkvtepldreriatytlfshavssngnavedpmeilitvtdq

SCOP Domain Coordinates for d2omtb1:

Click to download the PDB-style file with coordinates for d2omtb1.
(The format of our PDB-style files is described here.)

Timeline for d2omtb1: