Lineage for d2omta2 (2omt A:37-235)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823992Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 824043Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 824044Family c.10.2.1: Internalin LRR domain [52059] (3 proteins)
    capped at the N-end with a truncated EF-hand subdomain
  6. 824055Protein Internalin B [52060] (1 species)
  7. 824056Species Listeria monocytogenes [TaxId:1639] [52061] (9 PDB entries)
  8. 824064Domain d2omta2: 2omt A:37-235 [148880]
    Other proteins in same PDB: d2omta1, d2omtb1
    automatically matched to d1h6ta2
    complexed with ca, cl; mutant

Details for d2omta2

PDB Entry: 2omt (more details), 2 Å

PDB Description: Crystal structure of InlA G194S+S/hEC1 complex
PDB Compounds: (A:) Internalin-A

SCOP Domain Sequences for d2omta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omta2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}
titqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgvey
lnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqitd
idplknltnlnrlelssntisdisalsgltslqqlsfssnqvtdlkplanlttlerldis
snkvsdisvlakltnlesl

SCOP Domain Coordinates for d2omta2:

Click to download the PDB-style file with coordinates for d2omta2.
(The format of our PDB-style files is described here.)

Timeline for d2omta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omta1
View in 3D
Domains from other chains:
(mouse over for more information)
d2omtb1