Lineage for d2omta1 (2omt A:420-496)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789597Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 789608Protein Internalin B [69172] (1 species)
  7. 789609Species Listeria monocytogenes [TaxId:1639] [69173] (5 PDB entries)
  8. 789613Domain d2omta1: 2omt A:420-496 [148879]
    Other proteins in same PDB: d2omta2, d2omtb1
    automatically matched to d1h6ta1
    complexed with ca, cl; mutant

Details for d2omta1

PDB Entry: 2omt (more details), 2 Å

PDB Description: Crystal structure of InlA G194S+S/hEC1 complex
PDB Compounds: (A:) Internalin-A

SCOP Domain Sequences for d2omta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omta1 b.1.18.15 (A:420-496) Internalin B {Listeria monocytogenes [TaxId: 1639]}
napvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqpvt
igkgtttfsgtvtqplk

SCOP Domain Coordinates for d2omta1:

Click to download the PDB-style file with coordinates for d2omta1.
(The format of our PDB-style files is described here.)

Timeline for d2omta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omta2
View in 3D
Domains from other chains:
(mouse over for more information)
d2omtb1