SCOPe 2.08: Domain d2omta1: 2omt A:418-497

Lineage for d2omta1 (2omt A:418-497)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
   truncated fold fused to an LRR domain

6. Protein Internalin A [81973] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries)

8. Domain d2omta1: 2omt A:418-497 [148879]
   Other proteins in same PDB: d2omta3, d2omtb2, d2omtb3
   automated match to d2omza1
   complexed with ca, cl

Details for d2omta1

PDB Entry: 2omt, 2 Å

PDB Description: crystal structure of inla g194s+s/hec1 complex

PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omta1:

Sequence; same for both SEQRES and ATOM records:

>d2omta1 b.1.18.15 (A:418-497) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

Timeline for d2omta1:

• d2omta1 first appeared in SCOP 1.75
  
• d2omta1 appears in SCOPe 2.07