![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.11: PA3566-like [110970] (5 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein NE0621 [160287] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [160288] (1 PDB entry) Uniprot Q82WP3 1-98 |
![]() | Domain d2omoc2: 2omo C:1-98 [148873] Other proteins in same PDB: d2omoa2, d2omob3, d2omoc3, d2omod3, d2omof3, d2omog3, d2omoh3 automated match to d2omoa1 |
PDB Entry: 2omo (more details), 1.83 Å
SCOPe Domain Sequences for d2omoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omoc2 d.58.4.11 (C:1-98) Hypothetical protein NE0621 {Nitrosomonas europaea [TaxId: 915]} myvtivyasvktdkteafkeatrmnheqsirepgnmrfdilqsaddptrfvlyeayktrk daaahketahyltwrdtvadwmaeprkgviygglyptg
Timeline for d2omoc2: