SCOPe 2.08: Domain d2omob2: 2omo B:1-98

Lineage for d2omob2 (2omo B:1-98)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.11: PA3566-like [110970] (5 proteins)
subfamily of Pfam PF03992
Protein Hypothetical protein NE0621 [160287] (1 species)
Species Nitrosomonas europaea [TaxId:915] [160288] (1 PDB entry)
Uniprot Q82WP3 1-98
Domain d2omob2: 2omo B:1-98 [148872]
Other proteins in same PDB: d2omoa2, d2omob3, d2omoc3, d2omod3, d2omof3, d2omog3, d2omoh3
automated match to d2omoa1

Details for d2omob2

PDB Entry: 2omo (more details), 1.83 Å

PDB Description: putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea

PDB Compounds: (B:) duf176

SCOPe Domain Sequences for d2omob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omob2 d.58.4.11 (B:1-98) Hypothetical protein NE0621 {Nitrosomonas europaea [TaxId: 915]}
myvtivyasvktdkteafkeatrmnheqsirepgnmrfdilqsaddptrfvlyeayktrk
daaahketahyltwrdtvadwmaeprkgviygglyptg

SCOPe Domain Coordinates for d2omob2:

Click to download the PDB-style file with coordinates for d2omob2.
(The format of our PDB-style files is described here.)

Timeline for d2omob2: