Lineage for d2omoa1 (2omo A:1-98)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193416Family d.58.4.11: PA3566-like [110970] (5 proteins)
    subfamily of Pfam PF03992
  6. 2193417Protein Hypothetical protein NE0621 [160287] (1 species)
  7. 2193418Species Nitrosomonas europaea [TaxId:915] [160288] (1 PDB entry)
    Uniprot Q82WP3 1-98
  8. 2193419Domain d2omoa1: 2omo A:1-98 [148871]
    Other proteins in same PDB: d2omoa2, d2omob3, d2omoc3, d2omod3, d2omof3, d2omog3, d2omoh3

Details for d2omoa1

PDB Entry: 2omo (more details), 1.83 Å

PDB Description: putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea
PDB Compounds: (A:) duf176

SCOPe Domain Sequences for d2omoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omoa1 d.58.4.11 (A:1-98) Hypothetical protein NE0621 {Nitrosomonas europaea [TaxId: 915]}
myvtivyasvktdkteafkeatrmnheqsirepgnmrfdilqsaddptrfvlyeayktrk
daaahketahyltwrdtvadwmaeprkgviygglyptg

SCOPe Domain Coordinates for d2omoa1:

Click to download the PDB-style file with coordinates for d2omoa1.
(The format of our PDB-style files is described here.)

Timeline for d2omoa1: