Lineage for d2omaa1 (2oma A:2-251)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (18 species) 
Species Trypanosoma cruzi [TaxId:5693] [51358] (4 PDB entries)
Uniprot P52270
Domain d2omaa1: 2oma A:2-251 [148869]
automatically matched to d1suxa_
complexed with cs1, peg, pge, so4
Details for d2omaa1
PDB Entry: 2oma (more details), 2.15 Å
PDB Description: Crystallographic analysis of a chemically modified triosephosphate isomerase from Trypanosoma cruzi with dithiobenzylamine (DTBA)
PDB Compounds: (A:) triosephosphate isomeraseSCOP Domain Sequences for d2omaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omaa1 c.1.1.1 (A:2-251) Triosephosphate isomerase {Trypanosoma cruzi [TaxId: 5693]}
askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
efveiieatk
SCOP Domain Coordinates for d2omaa1:
Click to download the PDB-style file with coordinates for d2omaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2omaa1:
- d2omaa1 is new in SCOP 1.75
- d2omaa1 is called d2omaa_ in SCOPe 2.01
- d2omaa1 appears in the current release, SCOPe 2.08, called d2omaa_
View in 3D
