Lineage for d2om7n1 (2om7 N:7-241)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589041Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1589042Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1589043Protein Ribosomal protein S2 [52315] (3 species)
  7. 1589080Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 1589121Domain d2om7n1: 2om7 N:7-241 [148868]
    Other proteins in same PDB: d2om7e1, d2om7k1
    automatically matched to d1i94b_
    protein/RNA complex

Details for d2om7n1

PDB Entry: 2om7 (more details), 7.3 Å

PDB Description: structural basis for interaction of the ribosome with the switch regions of gtp-bound elongation factors
PDB Compounds: (N:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2om7n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2om7n1 c.23.15.1 (N:7-241) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe

SCOPe Domain Coordinates for d2om7n1:

Click to download the PDB-style file with coordinates for d2om7n1.
(The format of our PDB-style files is described here.)

Timeline for d2om7n1: