![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
![]() | Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) ![]() |
![]() | Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
![]() | Protein Ribosomal protein L1 [56810] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries) |
![]() | Domain d2om7k1: 2om7 K:18-224 [148867] Other proteins in same PDB: d2om7e1, d2om7n1 automatically matched to d2j01c1 protein/RNA complex |
PDB Entry: 2om7 (more details), 7.3 Å
SCOPe Domain Sequences for d2om7k1:
Sequence, based on SEQRES records: (download)
>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale ahkpegakgtflrsvyvtttmgpsvri
>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy vtttmgpsvri
Timeline for d2om7k1: