SCOPe 2.08: Domain d2om7k1: 2om7 K:18-224

Lineage for d2om7k1 (2om7 K:18-224)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
   2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)

4. Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family)
   automatically mapped to Pfam PF00687

5. Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)

6. Protein Ribosomal protein L1 [56810] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)

8. Domain d2om7k1: 2om7 K:18-224 [148867]
   Other proteins in same PDB: d2om7e1, d2om7n1
   automatically matched to d2j01c1
   protein/RNA complex

Details for d2om7k1

PDB Entry: 2om7, 7.3 Å

PDB Description: structural basis for interaction of the ribosome with the switch regions of gtp-bound elongation factors

PDB Compounds: (K:) 50s ribosomal protein l1

SCOPe Domain Sequences for d2om7k1:

Sequence, based on SEQRES records:

>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai
akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll
pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale
ahkpegakgtflrsvyvtttmgpsvri

Sequence, based on observed residues (ATOM records):

>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
vtttmgpsvri

Timeline for d2om7k1:

• d2om7k1 first appeared in SCOP 1.75
  
• d2om7k1 appears in SCOPe 2.07