Lineage for d2om7e1 (2om7 E:5-128)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268875Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2269074Domain d2om7e1: 2om7 E:5-128 [148866]
    Other proteins in same PDB: d2om7k1, d2om7n1
    automatically matched to d1gixo_
    protein/RNA complex

Details for d2om7e1

PDB Entry: 2om7 (more details), 7.3 Å

PDB Description: structural basis for interaction of the ribosome with the switch regions of gtp-bound elongation factors
PDB Compounds: (E:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2om7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2om7e1 i.1.1.1 (E:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d2om7e1:

Click to download the PDB-style file with coordinates for d2om7e1.
(The format of our PDB-style files is described here.)

Timeline for d2om7e1: