Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
Domain d2om7e1: 2om7 E:5-128 [148866] Other proteins in same PDB: d2om7k1, d2om7n1 automatically matched to d1gixo_ protein/RNA complex |
PDB Entry: 2om7 (more details), 7.3 Å
SCOPe Domain Sequences for d2om7e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2om7e1 i.1.1.1 (E:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d2om7e1: