Lineage for d2om2c1 (2om2 C:1061-1181)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771834Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 771835Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 771836Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 771837Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 771859Species Homo sapiens [TaxId:9606] [158559] (3 PDB entries)
  8. 771861Domain d2om2c1: 2om2 C:1061-1181 [148863]
    Other proteins in same PDB: d2om2a2, d2om2c2
    automatically matched to d1kjya1
    complexed with gdp, mg

Details for d2om2c1

PDB Entry: 2om2 (more details), 2.2 Å

PDB Description: Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14
PDB Compounds: (C:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOP Domain Sequences for d2om2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2om2c1 a.66.1.1 (C:1061-1181) Transducin (alpha subunit), insertion domain {Homo sapiens [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOP Domain Coordinates for d2om2c1:

Click to download the PDB-style file with coordinates for d2om2c1.
(The format of our PDB-style files is described here.)

Timeline for d2om2c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2om2c2