SCOPe 2.05: Domain d2om2a2: 2om2 A:30-60,A:182-349

Lineage for d2om2a2 (2om2 A:30-60,A:182-349)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Human (Homo sapiens) [TaxId:9606] [159560] (7 PDB entries)

8. Domain d2om2a2: 2om2 A:30-60,A:182-349 [148862]
   Other proteins in same PDB: d2om2a1, d2om2c1
   automatically matched to d1kjya2
   complexed with gdp, mg

Details for d2om2a2

PDB Entry: 2om2, 2.2 Å

PDB Description: Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2om2a2:

Sequence; same for both SEQRES and ATOM records:

>d2om2a2 c.37.1.8 (A:30-60,A:182-349) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
garevkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserk
kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
knvqfvfdavtdviiknnlk

Timeline for d2om2a2:

• d2om2a2 first appeared in SCOP 1.75
  
• d2om2a2 appears in SCOPe 2.04
  
• d2om2a2 appears in SCOPe 2.06
  
• d2om2a2 appears in the current release, SCOPe 2.08