Lineage for d2olua1 (2olu A:68-292)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 851243Family d.2.1.10: PBP transglycosylase domain-like [159832] (2 proteins)
    Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase
  6. 851248Protein Penicillin-binding protein 2, PBP2 [159835] (1 species)
  7. 851249Species Staphylococcus aureus [TaxId:1280] [159836] (3 PDB entries)
    Uniprot Q2YY56 67-292
  8. 851250Domain d2olua1: 2olu A:68-292 [148819]
    Other proteins in same PDB: d2olua2
    automatically matched to 2OLV A:67-292
    complexed with edo

Details for d2olua1

PDB Entry: 2olu (more details), 2.9 Å

PDB Description: Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme
PDB Compounds: (A:) Penicillin-binding protein 2

SCOP Domain Sequences for d2olua1:

Sequence, based on SEQRES records: (download)

>d2olua1 d.2.1.10 (A:68-292) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
klqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyk
rlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddi
fqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaae
drkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnid

Sequence, based on observed residues (ATOM records): (download)

>d2olua1 d.2.1.10 (A:68-292) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
klqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyg
fgsegastltqqvvkdaflsigrkaqeaylsyrleqeyskddifqvylnkiyysdgvtgi
kaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkntvlylmhyhkrit
dkqwedakkidlkanlvnrtpeerqnid

SCOP Domain Coordinates for d2olua1:

Click to download the PDB-style file with coordinates for d2olua1.
(The format of our PDB-style files is described here.)

Timeline for d2olua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2olua2