SCOPe 2.08: Domain d2olua1: 2olu A:68-292

Lineage for d2olua1 (2olu A:68-292)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins)
   Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase

6. Protein Penicillin-binding protein 2, PBP2 [159835] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [159836] (3 PDB entries)
   Uniprot Q2YY56 67-292

8. Domain d2olua1: 2olu A:68-292 [148819]
   Other proteins in same PDB: d2olua2
   automated match to d2olva1
   complexed with edo

Details for d2olua1

PDB Entry: 2olu, 2.9 Å

PDB Description: Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme

PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d2olua1:

Sequence, based on SEQRES records:

>d2olua1 d.2.1.10 (A:68-292) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
klqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyk
rlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddi
fqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaae
drkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnid

Sequence, based on observed residues (ATOM records):

>d2olua1 d.2.1.10 (A:68-292) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
klqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyg
fgsegastltqqvvkdaflsigrkaqeaylsyrleqeyskddifqvylnkiyysdgvtgi
kaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkntvlylmhyhkrit
dkqwedakkidlkanlvnrtpeerqnid

Timeline for d2olua1:

• d2olua1 first appeared in SCOP 1.75
  
• d2olua1 appears in SCOPe 2.07