SCOP 1.75: Domain d2okub1: 2oku B:445-560

Lineage for d2okub1 (2oku B:445-560)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.5: PG0775 C-terminal domain-like [158494] (1 family)

5. Family a.48.5.1: PG0775 C-terminal domain-like [158495] (1 protein)
   PfamB PB133436

6. Protein Uncharacterized protein PG0775 [158496] (1 species)
   Acyl-CoA dehydrogenase family protein

7. Species Porphyromonas gingivalis [TaxId:837] [158497] (1 PDB entry)
   Uniprot Q7MW70 443-564

8. Domain d2okub1: 2oku B:445-560 [148810]
   automatically matched to 2OKU A:443-564

Details for d2okub1

PDB Entry: 2oku, 1.9 Å

PDB Description: The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis

PDB Compounds: (B:) Acyl-CoA dehydrogenase family protein

SCOP Domain Sequences for d2okub1:

Sequence; same for both SEQRES and ATOM records:

>d2okub1 a.48.5.1 (B:445-560) Uncharacterized protein PG0775 {Porphyromonas gingivalis [TaxId: 837]}
vaairhittgtyiarireeyqqtevkpelqpmkealarmtdraealiafvteqkdqelld
fqarrlvemtahavfghllmlaandddsfrqsaevylrygqaeqekidsyvrafrp

Timeline for d2okub1:

• d2okub1 is new in SCOP 1.75
  
• d2okub1 is called d2okub_ in SCOPe 2.01
  
• d2okub1 appears in the current release, SCOPe 2.08, called d2okub_