Class a: All alpha proteins [46456] (290 folds) |
Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.5: PG0775 C-terminal domain-like [158494] (1 family) automatically mapped to Pfam PF12186 |
Family a.48.5.1: PG0775 C-terminal domain-like [158495] (1 protein) PfamB PB133436 |
Protein Uncharacterized protein PG0775 [158496] (1 species) Acyl-CoA dehydrogenase family protein |
Species Porphyromonas gingivalis [TaxId:837] [158497] (1 PDB entry) Uniprot Q7MW70 443-564 |
Domain d2okua1: 2oku A:443-564 [148809] |
PDB Entry: 2oku (more details), 1.9 Å
SCOPe Domain Sequences for d2okua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2okua1 a.48.5.1 (A:443-564) Uncharacterized protein PG0775 {Porphyromonas gingivalis [TaxId: 837]} qvvaairhittgtyiarireeyqqtevkpelqpmkealarmtdraealiafvteqkdqel ldfqarrlvemtahavfghllmlaandddsfrqsaevylrygqaeqekidsyvrafrpee lt
Timeline for d2okua1: