SCOPe 2.08: Domain d2okua1: 2oku A:443-564

Lineage for d2okua1 (2oku A:443-564)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.5: PG0775 C-terminal domain-like [158494] (1 family)
   automatically mapped to Pfam PF12186

5. Family a.48.5.1: PG0775 C-terminal domain-like [158495] (1 protein)
   PfamB PB133436

6. Protein Uncharacterized protein PG0775 [158496] (1 species)
   Acyl-CoA dehydrogenase family protein

7. Species Porphyromonas gingivalis [TaxId:837] [158497] (1 PDB entry)
   Uniprot Q7MW70 443-564

8. Domain d2okua1: 2oku A:443-564 [148809]

Details for d2okua1

PDB Entry: 2oku, 1.9 Å

PDB Description: The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis

PDB Compounds: (A:) Acyl-CoA dehydrogenase family protein

SCOPe Domain Sequences for d2okua1:

Sequence; same for both SEQRES and ATOM records:

>d2okua1 a.48.5.1 (A:443-564) Uncharacterized protein PG0775 {Porphyromonas gingivalis [TaxId: 837]}
qvvaairhittgtyiarireeyqqtevkpelqpmkealarmtdraealiafvteqkdqel
ldfqarrlvemtahavfghllmlaandddsfrqsaevylrygqaeqekidsyvrafrpee
lt

Timeline for d2okua1:

• d2okua1 first appeared in SCOP 1.75
  
• d2okua1 appears in SCOPe 2.07