Lineage for d2okqb2 (2okq B:1-117)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173154Family d.58.4.18: YbaA-like [160289] (1 protein)
    Pfam PF07237; DUF1428
  6. 2173155Protein Hypothetical protein YbaA [160290] (1 species)
  7. 2173156Species Shigella flexneri [TaxId:623] [160291] (1 PDB entry)
    Uniprot P0AAQ9 1-117
  8. 2173158Domain d2okqb2: 2okq B:1-117 [148808]
    Other proteins in same PDB: d2okqa2, d2okqb3
    automated match to d2okqa1
    complexed with na

Details for d2okqb2

PDB Entry: 2okq (more details), 1.8 Å

PDB Description: crystal structure of unknown conserved ybaa protein from shigella flexneri
PDB Compounds: (B:) Hypothetical protein ybaA

SCOPe Domain Sequences for d2okqb2:

Sequence, based on SEQRES records: (download)

>d2okqb2 d.58.4.18 (B:1-117) Hypothetical protein YbaA {Shigella flexneri [TaxId: 623]}
mkyvdgfvvavpadkkdayremaakaaplfkefgalrivecwasdvpdgkvtdfrmavka
eeneevvfswieypskevrdaanqkmmsdprmkefgesmpfdgkrmiyggfesiide

Sequence, based on observed residues (ATOM records): (download)

>d2okqb2 d.58.4.18 (B:1-117) Hypothetical protein YbaA {Shigella flexneri [TaxId: 623]}
mkyvdgfvvavpadkkdayremaakaaplfkefgalrivecwasdvpdgkvtdfrmavka
eeneevvfswieypskevrdaanqkmmsdprpfdgkrmiyggfesiide

SCOPe Domain Coordinates for d2okqb2:

Click to download the PDB-style file with coordinates for d2okqb2.
(The format of our PDB-style files is described here.)

Timeline for d2okqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2okqb3