SCOPe 2.08: Domain d2okqa1: 2okq A:1-117

Lineage for d2okqa1 (2okq A:1-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.18: YbaA-like [160289] (1 protein)
   Pfam PF07237; DUF1428

6. Protein Hypothetical protein YbaA [160290] (1 species)

7. Species Shigella flexneri [TaxId:623] [160291] (1 PDB entry)
   Uniprot P0AAQ9 1-117

8. Domain d2okqa1: 2okq A:1-117 [148807]
   Other proteins in same PDB: d2okqa2, d2okqb3
   complexed with na

Details for d2okqa1

PDB Entry: 2okq, 1.8 Å

PDB Description: crystal structure of unknown conserved ybaa protein from shigella flexneri

PDB Compounds: (A:) Hypothetical protein ybaA

SCOPe Domain Sequences for d2okqa1:

Sequence; same for both SEQRES and ATOM records:

>d2okqa1 d.58.4.18 (A:1-117) Hypothetical protein YbaA {Shigella flexneri [TaxId: 623]}
mkyvdgfvvavpadkkdayremaakaaplfkefgalrivecwasdvpdgkvtdfrmavka
eeneevvfswieypskevrdaanqkmmsdprmkefgesmpfdgkrmiyggfesiide

Timeline for d2okqa1:

• d2okqa1 first appeared in SCOP 1.75
  
• d2okqa1 appears in SCOPe 2.07