SCOPe 2.08: Domain d2okgb2: 2okg B:89-338

Lineage for d2okgb2 (2okg B:89-338)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 proteins)
   Pfam PF04198

6. Protein Central glycolytic gene regulator CggR [159554] (1 species)
   formerly hypothetical protein YvbQ

7. Species Bacillus subtilis [TaxId:1423] [159555] (5 PDB entries)
   Uniprot O32253 89-338

8. Domain d2okgb2: 2okg B:89-338 [148806]
   Other proteins in same PDB: d2okga2, d2okgb3
   automated match to d2okga1
   complexed with cl, g3h

Details for d2okgb2

PDB Entry: 2okg, 1.65 Å

PDB Description: Structure of effector binding domain of central glycolytic gene regulator (CggR) from B. subtilis

PDB Compounds: (B:) Central glycolytic gene regulator

SCOPe Domain Sequences for d2okgb2:

Sequence; same for both SEQRES and ATOM records:

>d2okgb2 c.124.1.8 (B:89-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]}
kdvlgltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavt
ggttieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpg
qlsqgayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavt
eafgyyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvt
degaakkllr

Timeline for d2okgb2:

• d2okgb2 first appeared in SCOP 1.75, called d2okgb1
  
• d2okgb2 appears in SCOPe 2.07