Lineage for d2okga1 (2okg A:89-338)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849026Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 849027Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families) (S)
  5. 849230Family c.124.1.8: SorC sugar-binding domain-like [159545] (5 proteins)
    Pfam PF04198
  6. 849231Protein Central glycolytic gene regulator CggR [159554] (1 species)
    formerly hypothetical protein YvbQ
  7. 849232Species Bacillus subtilis [TaxId:1423] [159555] (5 PDB entries)
    Uniprot O32253 89-338
  8. 849233Domain d2okga1: 2okg A:89-338 [148805]
    complexed with cl, g3h

Details for d2okga1

PDB Entry: 2okg (more details), 1.65 Å

PDB Description: Structure of effector binding domain of central glycolytic gene regulator (CggR) from B. subtilis
PDB Compounds: (A:) Central glycolytic gene regulator

SCOP Domain Sequences for d2okga1:

Sequence, based on SEQRES records: (download)

>d2okga1 c.124.1.8 (A:89-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]}
kdvlgltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavt
ggttieavaemmtpdsknrellfvpargglgedvknqanticahmaekasgtyrllfvpg
qlsqgayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavt
eafgyyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvt
degaakkllr

Sequence, based on observed residues (ATOM records): (download)

>d2okga1 c.124.1.8 (A:89-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]}
kdvlgltllektlkerlnlkdaiivsgdsdqspwvkkemgraavacmkkrfsgknivavt
ggttieavaemmtpdsknrellfvpargglgknqanticahmaekasgtyrllfvpgqls
qgayssiieepsvkevlntiksasmlvhgigeaktmaqrrntpledlkkiddndavteaf
gyyfnadgevvhkvhsvgmqlddidaipdiiavaggsskaeaieayfkkprntvlvtdeg
aakkllr

SCOP Domain Coordinates for d2okga1:

Click to download the PDB-style file with coordinates for d2okga1.
(The format of our PDB-style files is described here.)

Timeline for d2okga1: