Lineage for d2okcb_ (2okc B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146325Family c.66.1.45: N-6 DNA Methylase-like [142606] (3 proteins)
    Pfam PF02384; contains C-terminal extension to the canonical fold and extra N-terminal all-alpha domain similar to the insert domain of the DAM family (88788)
  6. 2146333Protein Type I restriction enzyme StySJI M protein [159684] (1 species)
  7. 2146334Species Bacteroides thetaiotaomicron [TaxId:818] [159685] (1 PDB entry)
    Uniprot Q89Z59 9-433
  8. 2146336Domain d2okcb_: 2okc B: [148802]
    automated match to d2okca1
    complexed with cl, gol, ipa, sam

Details for d2okcb_

PDB Entry: 2okc (more details), 2.2 Å

PDB Description: crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
PDB Compounds: (B:) Type I restriction enzyme StySJI M protein

SCOPe Domain Sequences for d2okcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2okcb_ c.66.1.45 (B:) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}
teqsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwad
liafdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimd
gdvkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfll
taydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedsle
kepstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvl
pdnvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfyd
yrtdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktsld
itwikp

SCOPe Domain Coordinates for d2okcb_:

Click to download the PDB-style file with coordinates for d2okcb_.
(The format of our PDB-style files is described here.)

Timeline for d2okcb_: