Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.45: N-6 DNA Methylase-like [142606] (3 proteins) Pfam PF02384; contains C-terminal extension to the canonical fold and extra N-terminal all-alpha domain similar to the insert domain of the DAM family (88788) |
Protein Type I restriction enzyme StySJI M protein [159684] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [159685] (1 PDB entry) Uniprot Q89Z59 9-433 |
Domain d2okcb_: 2okc B: [148802] automated match to d2okca1 complexed with cl, gol, ipa, sam |
PDB Entry: 2okc (more details), 2.2 Å
SCOPe Domain Sequences for d2okcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2okcb_ c.66.1.45 (B:) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} teqsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwad liafdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimd gdvkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfll taydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedsle kepstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvl pdnvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfyd yrtdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktsld itwikp
Timeline for d2okcb_: