SCOPe 2.02: Domain d2okcb_: 2okc B:

Lineage for d2okcb_ (2okc B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.45: N-6 DNA Methylase-like [142606] (3 proteins)
   Pfam PF02384; contains C-terminal extension to the canonical fold and extra N-terminal all-alpha domain similar to the insert domain of the DAM family (88788)

6. Protein Type I restriction enzyme StySJI M protein [159684] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [159685] (1 PDB entry)
   Uniprot Q89Z59 9-433

8. Domain d2okcb_: 2okc B: [148802]
   automated match to d2okca1
   complexed with cl, gol, ipa, sam

Details for d2okcb_

PDB Entry: 2okc, 2.2 Å

PDB Description: crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution

PDB Compounds: (B:) Type I restriction enzyme StySJI M protein

SCOPe Domain Sequences for d2okcb_:

Sequence; same for both SEQRES and ATOM records:

>d2okcb_ c.66.1.45 (B:) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}
teqsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwad
liafdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimd
gdvkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfll
taydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedsle
kepstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvl
pdnvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfyd
yrtdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktsld
itwikp

Timeline for d2okcb_:

• d2okcb_ first appeared in SCOP 1.75, called d2okcb1
  
• d2okcb_ appears in SCOPe 2.01
  
• d2okcb_ appears in SCOPe 2.03
  
• d2okcb_ appears in the current release, SCOPe 2.08