SCOP 1.75: Domain d2okcb1: 2okc B:9-432

Lineage for d2okcb1 (2okc B:9-432)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.45: N-6 DNA Methylase-like [142606] (3 proteins)
   Pfam PF02384; contains C-terminal extension to the canonical fold and extra N-terminal all-alpha domain similar to the insert domain of the DAM family ((88788))

6. Protein Type I restriction enzyme StySJI M protein [159684] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [159685] (1 PDB entry)
   Uniprot Q89Z59 9-433

8. Domain d2okcb1: 2okc B:9-432 [148802]
   automatically matched to 2OKC A:9-433
   complexed with cl, gol, ipa, sam

Details for d2okcb1

PDB Entry: 2okc, 2.2 Å

PDB Description: crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution

PDB Compounds: (B:) Type I restriction enzyme StySJI M protein

SCOP Domain Sequences for d2okcb1:

Sequence; same for both SEQRES and ATOM records:

>d2okcb1 c.66.1.45 (B:9-432) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}
qsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwadli
afdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimdgd
vkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfllta
ydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedsleke
pstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvlpd
nvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfydyr
tdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktsldit
wikp

Timeline for d2okcb1:

• d2okcb1 is new in SCOP 1.75
  
• d2okcb1 is called d2okcb_ in SCOPe 2.01
  
• d2okcb1 appears in the current release, SCOPe 2.08, called d2okcb_